PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G0587
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GRAS
Protein Properties Length: 604aa    MW: 67384.2 Da    PI: 4.6627
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G0587genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS278.32.3e-852316022374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl...fsevsPilkfsh 95 
                    lLl++Ae v  ++ e a++lL++   ++s++g+p+qR++ yf eAL++++ r ++ + +k+l+ ++  +   ++ +a   +    + ++P+ ++s+
  Gh_D02G0587 231 AALLLAAAEKVGYQQYESASRLLKQCDYMSSKTGNPVQRVVYYFSEALREKIEReTGRSSSKSLKWKPLCNF-DTDMIALNPTvlaCHGAFPFGQVSQ 327
                  579***************************************************666677777776666533.3444444333455899********* PP

         GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                  ++  qaI+e v+++++vHiiD+ i++G+QW  L+qaLa R+       l+iT+v+    + k+ +  tg+rL++fA++lgvpf f+v++++++ dl+ 
  Gh_D02G0587 328 FAGIQAIVENVAEANKVHIIDLAIKNGIQWTILIQALAPRQheYRLELLKITAVAT---EAKDLIDGTGKRLSSFAQSLGVPFAFKVVMVSDMLDLKE 422
                  ****************************************95555679********...469999********************************* PP

         GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErel 289
                  + ++++ +E+++   +++  ++l+ +  +e+    ++k+++ ++P ++vv+e ea+hns+ F++rf+e l y+sa fd++++ + ++s++r  +E ++
  Gh_D02G0587 423 DFFELDAEETIVAYAAFAFRSMLATPNRIEN----IMKVLRVMNPCLMVVTEVEANHNSPIFVNRFIEVLFYFSAYFDCIATCMEQDSKNREIIESVF 516
                  ***********************77777777....*************************************************************** PP

         GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +g  i+n+va+eg++r+ r+ ++  Wr+ + + G+++++ls +   qa+l+l++++ +   +++ + ++l+ gWk+ p+ s+S+W+
  Gh_D02G0587 517 FGDGIRNMVAAEGTDRKVRNVKFDVWRAFFVRYGMEEAELSMSSKYQADLILKTFAcGTCCTLDMNGKCLLVGWKGTPMHSISVWK 602
                  ********************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.933204581IPR005202Transcription factor GRAS
PfamPF035147.8E-83231602IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MGNDVFSFVD LNVYGAPDKL SSSNNEFESF DGGNKGKAGG FYGVEDWGET GGNDSLPSDY  60
GFYGDAPMEA SGFSFFKQDH HQQQQQQQEQ QSFIEYGLHN GVSFNAQSPL IQACFDEIAE  120
LGGINNGVYE DIGEAKKGKQ YPGLSSLGLL NNYGNGFKRL NGERKTDDDI TVSDTQDEDR  180
KLSTEEVMRV AGEMFLKSCG QTIDGISGID HPFSLSFSGF LDRETRDIEL AALLLAAAEK  240
VGYQQYESAS RLLKQCDYMS SKTGNPVQRV VYYFSEALRE KIERETGRSS SKSLKWKPLC  300
NFDTDMIALN PTVLACHGAF PFGQVSQFAG IQAIVENVAE ANKVHIIDLA IKNGIQWTIL  360
IQALAPRQHE YRLELLKITA VATEAKDLID GTGKRLSSFA QSLGVPFAFK VVMVSDMLDL  420
KEDFFELDAE ETIVAYAAFA FRSMLATPNR IENIMKVLRV MNPCLMVVTE VEANHNSPIF  480
VNRFIEVLFY FSAYFDCIAT CMEQDSKNRE IIESVFFGDG IRNMVAAEGT DRKVRNVKFD  540
VWRAFFVRYG MEEAELSMSS KYQADLILKT FACGTCCTLD MNGKCLLVGW KGTPMHSISV  600
WKFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3723660214375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.139284e-54boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6146092e-48JX614609.1 Gossypium hirsutum clone NBRI_GE58134 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012482188.10.0PREDICTED: DELLA protein RGL2-like
TrEMBLA0A0D2SBU60.0A0A0D2SBU6_G
STRINGPOPTR_0010s15370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM157861014
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-56RGA-like 2